Pfam domain
Pfam family: Ribosomal_L31e (PF01198.18)
Uniprot AC: Q5XLD9
RecName: Putative 60S ribosomal protein L31
Begin-End: 18-96
Organism: Zea mays
Interaction Mode:   

Sequence:
TREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTTDIRIDVKLNKHIWSSGIRSVP
RRVRVRIARKRNDEEDAKE
Structures of the domain Q5XLD9 18-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2go5 X-ray 7.4 6 17-95 None


© NPIDB team 2003 - 2019

text