Pfam domain
Pfam family: MarR_2 (PF12802.9)
Uniprot AC: Q5Y812
RecName: MarR family regulatory protein
Begin-End: 27-88
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
FDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDT
RR
Structures of the domain Q5Y812 27-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lln X-ray 2.84 I 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lln X-ray 2.84 J 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lln X-ray 2.84 D 27-89  H-Bb H-Mj S-Bb L-Bb L-Mj 
4lln X-ray 2.84 C 27-89  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lln X-ray 2.84 A 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lln X-ray 2.84 B 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5fb2 X-ray 1.8 A 27-88 None
4lll X-ray 3.04 O 27-88 None
4lll X-ray 3.04 M 27-88 None
4lll X-ray 3.04 J 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj 
4lll X-ray 3.04 I 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lll X-ray 3.04 D 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4lll X-ray 3.04 C 27-88  H-Bb H-Mj L-Bb L-Mj L-Mn 
4lll X-ray 3.04 B 27-88  H-Bb H-Mj L-Bb L-Mj L-Mn 
4lll X-ray 3.04 A 27-88  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text