Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q62424
RecName: Homeobox protein Hox-A13
Begin-End: 321-377
Organism: Mus musculus
Interaction Mode:   

Sequence:
RKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKK
Structures of the domain Q62424 321-377
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ld5 NMR A 8-64  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text