Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q63245
RecName: Forkhead box protein D3 (Fragment)
Begin-End: 2-88
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF
VKIPREPGNPGKGNYWTLDPQSEDMFD
Structures of the domain Q63245 2-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hdc NMR A 3-87  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text