Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: Q64249
RecName: Nuclear receptor subfamily 6 group A member 1
Begin-End: 74-142
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
TCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLL
KCLQMGMNR
Structures of the domain Q64249 74-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5krb X-ray 2.1 G 74-142  H-Bb H-Mj S-Bb L-Bb 
5krb X-ray 2.1 B 74-142  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text