Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q6AZJ8
RecName: Histone H2A
Begin-End: 10-91
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
KTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAVRND
Structures of the domain Q6AZJ8 10-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fq5 X-ray 3.8 C 13-88 None
6fq5 X-ray 3.8 G 13-88 None


© NPIDB team 2003 - 2019

text