Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q6AZJ8
RecName: Histone H2A
Begin-End: 15-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDN
KKTRIIPRHLQLAVRND
Structures of the domain Q6AZJ8 15-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mgr X-ray 2.3 G 17-88 None
3mgr X-ray 2.3 C 18-88 None
6esi X-ray 6.3 G 19-88 None
6esi X-ray 6.3 C 20-88 None
3kxb X-ray 3.2 C 18-88 None
6fq8 X-ray 4.8 G 16-88 None
6fq8 X-ray 4.8 C 17-88 None
6fq6 X-ray 4 C 15-88 None
6fq6 X-ray 4 G 15-88 None
3lel X-ray 2.95 G 17-88 None
3lel X-ray 2.95 C 18-88 None
3lel X-ray 2.95 Q 17-88 None
3lel X-ray 2.95 M 18-88 None
3mvd X-ray 2.9 C 16-88  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 G 16-88  H-Bb S-Bb L-Bb 
4kgc X-ray 2.69 G 18-88 None
4kgc X-ray 2.69 C 18-88 None
3lz0 X-ray 2.5 G 18-88 None
3lz0 X-ray 2.5 C 19-88 None
3lz1 X-ray 2.5 G 18-88 None
3lz1 X-ray 2.5 C 19-88 None
3mgq X-ray 2.65 G 17-88 None
3mgq X-ray 2.65 C 18-88 None
6esf X-ray 3.7 C 19-88 None
6esf X-ray 3.7 G 19-88 None
3mgp X-ray 2.44 G 17-88 None
3mgp X-ray 2.44 C 18-88 None
6esh X-ray 5.1 G 19-88 None
6esh X-ray 5.1 C 19-88 None
3mgs X-ray 3.15 G 17-88 None
3mgs X-ray 3.15 C 18-88 None
6esg X-ray 5.4 G 19-88 None
6esg X-ray 5.4 C 19-88 None


© NPIDB team 2003 - 2019

text