Pfam domain
Pfam family: Ribosomal_S10 (PF00338.21)
Uniprot AC: Q6CIM1
RecName: KLLA0F25542p
Begin-End: 20-114
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
RINLTSTKVKQLENVSANIIKNAETFKLVKKGPVRLPTKVLKISTRKTPNGEGSKTWDTY
EMRIHKRYIDLEAPAHIVKRITQITIEPGVDVEVI
Structures of the domain Q6CIM1 20-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 U 23-116 None
3j80 X-ray 3.75 U 23-116 None
3jam X-ray 3.46 U 23-116 None
3jaq X-ray 6 U 23-116 None
3j81 X-ray 4 U 23-116 None
3jap X-ray 4.9 U 23-116 None


© NPIDB team 2003 - 2019

text