Pfam domain
Pfam family: Ribosomal_S13_N (PF08069.11)
Uniprot AC: Q6CJK0
RecName: KLLA0F18040p
Begin-End: 2-60
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGV
Structures of the domain Q6CJK0 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 N 2-60 None
3j80 X-ray 3.75 N 2-60 None
3jam X-ray 3.46 N 2-60 None
3jaq X-ray 6 N 2-60 None
3j81 X-ray 4 N 2-60 None
3jap X-ray 4.9 N 2-60 None


© NPIDB team 2003 - 2019

text