Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: Q6CJK0
RecName: KLLA0F18040p
Begin-End: 70-148
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
KILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYY
RTVSVLPPNWKYESATASA
Structures of the domain Q6CJK0 70-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 N 74-147 None
3j80 X-ray 3.75 N 74-147 None
3jam X-ray 3.46 N 74-147 None
3jaq X-ray 6 N 74-147 None
3j81 X-ray 4 N 74-147 None
3jap X-ray 4.9 N 74-147 None


© NPIDB team 2003 - 2019

text