Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: Q6CKL3
RecName: KLLA0F09812p
Begin-End: 81-145
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
LKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLS
VIPIR
Structures of the domain Q6CKL3 81-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 C 81-145 None
3j80 X-ray 3.75 C 47-145 None
3jam X-ray 3.46 C 81-145 None
3jaq X-ray 6 C 48-145 None
3j81 X-ray 4 C 81-145 None
3jap X-ray 4.9 C 81-145 None


© NPIDB team 2003 - 2019

text