Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: Q6CKV4
RecName: KLLA0F07843p
Begin-End: 43-128
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
RKFARGLSEKPAGLMKKLRAAKLSAPENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVF
NQVEIRPEMVGHYLGEFSITYTPVRH
Structures of the domain Q6CKV4 43-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 P 43-128 None
3j80 X-ray 3.75 P 43-128 None
3jam X-ray 3.46 P 43-128 None
3jaq X-ray 6 P 133-128 None
3j81 X-ray 4 P 43-128 None
3jap X-ray 4.9 P 43-128 None


© NPIDB team 2003 - 2019

text