Pfam domain
Pfam family: Ribosomal_S6e (PF01092.18)
Uniprot AC: Q6CM04
RecName: 40S ribosomal protein S6
Begin-End: 1-126
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
MKLNISYPINGTQKCIEIDDEHRVRVFYDKRIGQEVDGESVGDEFKGYVFKIAGGNDKQG
FPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGAIVGPDLAVLALIITKKGEQE
IEGITN
Structures of the domain Q6CM04 1-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 G 1-125 None
3j80 X-ray 3.75 G 3-127 None
3jam X-ray 3.46 G 1-125 None
3jaq X-ray 6 G 3-127 None
3j81 X-ray 4 G 1-125 None
3jap X-ray 4.9 G 3-127 None


© NPIDB team 2003 - 2019

text