Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: Q6CM18
RecName: KLLA0E23673p
Begin-End: 107-153
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
RRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLESE
Structures of the domain Q6CM18 107-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 J 107-151 None
3j80 X-ray 3.75 J 107-151 None
3jam X-ray 3.46 J 107-151 None
3jaq X-ray 6 J 108-152 None
3j81 X-ray 4 J 108-152 None
3jap X-ray 4.9 J 107-151 None


© NPIDB team 2003 - 2019

text