Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: Q6CM18
RecName: KLLA0E23673p
Begin-End: 2-128
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
PRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRISFQLSKIRRAARDLLT
RDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKS
VHHARVL
Structures of the domain Q6CM18 2-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 J 15-61 None
3j80 X-ray 3.75 J 15-61 None
3jam X-ray 3.46 J 36-82 None
3jaq X-ray 6 J 16-62 None
3j81 X-ray 4 J 16-62 None
3jap X-ray 4.9 J 15-61 None


© NPIDB team 2003 - 2019

text