Pfam domain
Pfam family: Ribosomal_S8e (PF01201.21)
Uniprot AC: Q6CMG3
RecName: 40S ribosomal protein S8
Begin-End: 2-185
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GISRDSRHKRAATGAKRAQFRKKRKFELGRQAANTKIGTKRIHPVRTRGGNQKFRALRIE
TGNFSWASEGVARKTRITGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWYESHYGQSL
GKKKNTKAEEETATTSKNTERKWAARAAEAKIEHAVDSQFGAGRLYAAISSRPGQSGRCD
GYIL
Structures of the domain Q6CMG3 2-185
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 I 2-185 None
3j80 X-ray 3.75 I 22-185 None
3jam X-ray 3.46 I 22-185 None
3jaq X-ray 6 I 2-185 None
3j81 X-ray 4 I 2-185 None
3jap X-ray 4.9 I 2-185 None


© NPIDB team 2003 - 2019

text