Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: Q6CN12
RecName: 40S ribosomal protein S0
Begin-End: 111-183
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
ITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSI
GLIWYLLAREVLR
Structures of the domain Q6CN12 111-183
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 A 116-181 None
3j80 X-ray 3.75 A 116-181 None
3jam X-ray 3.46 A 116-181 None
3jaq X-ray 6 A 116-181 None
3j81 X-ray 4 A 116-181 None
3jap X-ray 4.9 A 116-181 None


© NPIDB team 2003 - 2019

text