|
Pfam domain
|
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q6CNI7
RecName: KLLA0E12277p
Begin-End: 194-231
Organism: Kluyveromyces lactis
Interaction Mode:
Sequence:
RIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWN
|
|
Structures of the domain Q6CNI7 194-231
| PDB ID |
Exp. data |
Chain |
Begin-End |
Interaction mode |
| 3jaq |
X-ray 6 |
g |
57-94 |
None |
| 3jam |
X-ray 3.46 |
g |
55-92 |
None |
| 3jap |
X-ray 4.9 |
g |
57-94 |
None |
| 3j81 |
X-ray 4 |
g |
55-92 |
None |
| 5it9 |
X-ray 3.8 |
g |
57-94 |
None |
| 3j80 |
X-ray 3.75 |
g |
55-92 |
None |
|
|
|
|
|
