Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q6CNI7
RecName: KLLA0E12277p
Begin-End: 286-321
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
AGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQ
Structures of the domain Q6CNI7 286-321
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 g 101-134 None
5it9 X-ray 3.8 g 191-223 None
3j80 X-ray 3.75 g 199-231 None
3j80 X-ray 3.75 g 103-136 None
3jam X-ray 3.46 g 101-134 None
3jam X-ray 3.46 g 191-223 None
3jaq X-ray 6 g 103-136 None
3jaq X-ray 6 g 199-231 None
3j81 X-ray 4 g 191-223 None
3j81 X-ray 4 g 101-134 None
3jap X-ray 4.9 g 199-231 None
3jap X-ray 4.9 g 103-136 None


© NPIDB team 2003 - 2019

text