Pfam domain
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: Q6CNL2
RecName: 40S ribosomal protein S27
Begin-End: 28-82
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
PRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Structures of the domain Q6CNL2 28-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 b 28-82 None
3j80 X-ray 3.75 b 28-82 None
3jam X-ray 3.46 b 37-91 None
3jaq X-ray 6 b 38-92 None
3j81 X-ray 4 b 28-82 None
3jap X-ray 4.9 b 38-92 None


© NPIDB team 2003 - 2019

text