|
Pfam domain
|
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: Q6CNL2
RecName: 40S ribosomal protein S27
Begin-End: 28-82
Organism: Kluyveromyces lactis
Interaction Mode:
Sequence:
PRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
|
|
Structures of the domain Q6CNL2 28-82
| PDB ID |
Exp. data |
Chain |
Begin-End |
Interaction mode |
| 5it9 |
X-ray 3.8 |
b |
28-82 |
None |
| 3j80 |
X-ray 3.75 |
b |
28-82 |
None |
| 3jam |
X-ray 3.46 |
b |
37-91 |
None |
| 3jaq |
X-ray 6 |
b |
38-92 |
None |
| 3j81 |
X-ray 4 |
b |
28-82 |
None |
| 3jap |
X-ray 4.9 |
b |
38-92 |
None |
|
|
|
|
|
