Pfam domain
Pfam family: Ribosomal_S14 (PF00253.20)
Uniprot AC: Q6CPG3
RecName: 40S ribosomal protein S29
Begin-End: 6-56
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
VWYSHPRKFGKGSRQCRISGSHSGLIRKYGLNIDRQSFREKANDIGFYKYR
Structures of the domain Q6CPG3 6-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 d 7-56 None
3j80 X-ray 3.75 d 6-55 None
3jam X-ray 3.46 d 7-56 None
3jaq X-ray 6 d 7-56 None
3j81 X-ray 4 d 6-55 None
3jap X-ray 4.9 d 7-56 None


© NPIDB team 2003 - 2019

text