Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: Q6CRA3
RecName: KLLA0D10659p
Begin-End: 74-227
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
HTAGRYANKRFRKAQCPIVERLTNSLMMNGRNNGKKLKAVRIVKHTLEIINVLTDQNPLQ
VVVDAIINSGPREDTTRVGGGGAARRQAVDVSPLRRVNQSIALLTIGAREAAFRNIKTIA
ETLAEELINAAKGSSTSYAIKKKDELERVAKSNR
Structures of the domain Q6CRA3 74-227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 F 145-227 None
3j80 X-ray 3.75 F 145-227 None
3jam X-ray 3.46 F 145-227 None
3jaq X-ray 6 F 145-227 None
3j81 X-ray 4 F 85-227 None
3jap X-ray 4.9 F 145-227 None


© NPIDB team 2003 - 2019

text