Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: Q6CRK7
RecName: KLLA0D08305p
Begin-End: 20-96
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
ELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKY
KRGTIALYAERVHDRGL
Structures of the domain Q6CRK7 20-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 D 21-92 None
3j80 X-ray 3.75 D 20-92 None
3jam X-ray 3.46 D 21-92 None
3jaq X-ray 6 D 21-92 None
3j81 X-ray 4 D 20-92 None
3jap X-ray 4.9 D 21-92 None


© NPIDB team 2003 - 2019

text