Pfam domain
Pfam family: Ribosomal_S26e (PF01283.18)
Uniprot AC: Q6CS01
RecName: 40S ribosomal protein S26
Begin-End: 2-98
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIRDLSEASVYAE
YALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPP
Structures of the domain Q6CS01 2-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 a 2-99 None
3jam X-ray 3.46 a 2-99 None
3jap X-ray 4.9 a 2-99 None
3j81 X-ray 4 a 2-98 None
5it9 X-ray 3.8 a 1-100 None
3j80 X-ray 3.75 a 2-98 None


© NPIDB team 2003 - 2021

text