Pfam domain
Pfam family: Ribosomal_S7e (PF01251.17)
Uniprot AC: Q6CTD6
RecName: 40S ribosomal protein S7
Begin-End: 5-187
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
QAKILSQAPTELELQVAQAFIDLENNSPELKADLRALQFKSIREIEVAGGKKALAVFVPV
PSLAAYHKVQIKLTRELEKKFQDRHVIFLAERRILPKPSRKSRQTQKRPRSRTLTAVHDK
ILEDLVFPTEIVGKRVRYLVGGNKIQKILLNSKDVQHIDNKLESFQAVYNKLTGKQIVFE
IPS
Structures of the domain Q6CTD6 5-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 H 9-186 None
3j80 X-ray 3.75 H 6-186 None
3jam X-ray 3.46 H 6-186 None
3jaq X-ray 6 H 6-186 None
3j81 X-ray 4 H 6-186 None
3jap X-ray 4.9 H 6-186 None


© NPIDB team 2003 - 2019

text