Pfam domain
Pfam family: Ribosomal_S24e (PF01282.18)
Uniprot AC: Q6CU44
RecName: 40S ribosomal protein S24
Begin-End: 24-102
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
VVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAK
KFEPAYRLVRYGLAEKVEK
Structures of the domain Q6CU44 24-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 Y 24-102 None
3jam X-ray 3.46 Y 24-102 None
3jap X-ray 4.9 Y 24-102 None
3j81 X-ray 4 Y 24-102 None
5it9 X-ray 3.8 Y 24-102 None
3j80 X-ray 3.75 Y 24-102 None


© NPIDB team 2003 - 2021

text