Pfam domain
Pfam family: Ribosomal_S30 (PF04758.13)
Uniprot AC: Q6CUH5
RecName: 40S ribosomal protein S30
Begin-End: 9-61
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
ARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYTRRFVNVTLTNGKRKMNPSPS
Structures of the domain Q6CUH5 9-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 e 2-53 None
3j80 X-ray 3.75 e 9-60 None
3jam X-ray 3.46 e 9-60 None
3jaq X-ray 6 e 2-54 None
3j81 X-ray 4 e 2-54 None
3jap X-ray 4.9 e 2-54 None


© NPIDB team 2003 - 2019

text