Pfam domain
Pfam family: S10_plectin (PF03501.14)
Uniprot AC: Q6CVZ5
RecName: KLLA0B08173p
Begin-End: 3-95
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
IPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQ
YYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQ
Structures of the domain Q6CVZ5 3-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 K 3-91 None
3j80 X-ray 3.75 K 3-91 None
3jam X-ray 3.46 K 3-91 None
3jaq X-ray 6 K 100-204 None
3j81 X-ray 4 K 100-208 None
3jap X-ray 4.9 K 100-204 None


© NPIDB team 2003 - 2019

text