Pfam domain
Pfam family: Ribosomal_S8 (PF00410.18)
Uniprot AC: Q6CW21
RecName: 40S ribosomal protein S22
Begin-End: 5-130
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
SVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQ
LNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGK
ILGFVY
Structures of the domain Q6CW21 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 W 7-130 None
3j80 X-ray 3.75 W 7-130 None
3jam X-ray 3.46 W 7-130 None
3jaq X-ray 6 W 7-130 None
3j81 X-ray 4 W 7-130 None
3jap X-ray 4.9 W 7-130 None


© NPIDB team 2003 - 2019

text