Pfam domain
Pfam family: Ribosomal_S25 (PF03297.14)
Uniprot AC: Q6CW78
RecName: KLLA0B06182p
Begin-End: 36-104
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKH
SKQAIYTRA
Structures of the domain Q6CW78 36-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 Z 37-104 None
3j80 X-ray 3.75 Z 37-104 None
3jam X-ray 3.46 Z 37-104 None
3jaq X-ray 6 Z 37-104 None
3j81 X-ray 4 Z 37-104 None
3jap X-ray 4.9 Z 37-104 None


© NPIDB team 2003 - 2019

text