Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: Q6CWD0
RecName: 40S ribosomal protein S1
Begin-End: 20-221
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
VVDPFTRKEWYDIKAPSTFENRNVGKTLVNKSVGLKNASDSLKGRVVEVCLADLQGSEDH
SFRKVKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQTLIEANVTVKTSDDYVLRIFA
IAFTRKQANQVKRTSYAQSSHIRQIRKVISEILTREVQNSTLAQLTSKLIPEVINKEIEN
ATKDIFPLQNVHIRKVKLLKQP
Structures of the domain Q6CWD0 20-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 B 1-221 None
3j80 X-ray 3.75 B 2-221 None
3jam X-ray 3.46 B 9-221 None
3jaq X-ray 6 B 9-221 None
3j81 X-ray 4 B 2-221 None
3jap X-ray 4.9 B 9-221 None


© NPIDB team 2003 - 2019

text