Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: Q6CWJ2
RecName: 40S ribosomal protein S4
Begin-End: 42-90
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
LPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVI
Structures of the domain Q6CWJ2 42-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 E 43-90 None
3j80 X-ray 3.75 E 50-90 None
3jam X-ray 3.46 E 50-90 None
3jaq X-ray 6 E 43-90 None
3j81 X-ray 4 E 43-90 None
3jap X-ray 4.9 E 43-90 None


© NPIDB team 2003 - 2019

text