Pfam domain
Pfam family: Ribosomal_S4e (PF00900.19)
Uniprot AC: Q6CWJ2
RecName: 40S ribosomal protein S4
Begin-End: 95-169
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
TNENFRLVYDVKGRFAVHRITDEEASYKLAKVKKVQLGKKGIPYVVTHDGRTIRYPDPNI
KVNDTVKVDLATGTI
Structures of the domain Q6CWJ2 95-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 E 95-169 None
3j80 X-ray 3.75 E 95-169 None
3jam X-ray 3.46 E 95-169 None
3jaq X-ray 6 E 95-169 None
3j81 X-ray 4 E 95-169 None
3jap X-ray 4.9 E 95-169 None


© NPIDB team 2003 - 2019

text