Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: Q6CWT9
RecName: KLLA0B01562p
Begin-End: 16-144
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
RLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQN
PTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRG
QHTKTTGRR
Structures of the domain Q6CWT9 16-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 S 16-144 None
3j80 X-ray 3.75 S 16-144 None
3jam X-ray 3.46 S 16-144 None
3jaq X-ray 6 S 59-144 None
3j81 X-ray 4 S 16-144 None
3jap X-ray 4.9 S 59-144 None


© NPIDB team 2003 - 2019

text