Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: Q6CWU3
RecName: KLLA0B01474p
Begin-End: 2-126
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRI
QKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSNDVLNVDTQTAELVNSLGLKLPLSV
SSVSA
Structures of the domain Q6CWU3 2-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 R 2-116 None
3j80 X-ray 3.75 R 2-116 None
3jam X-ray 3.46 R 2-116 None
3jaq X-ray 6 R 704-116 None
3j81 X-ray 4 R 2-116 None
3jap X-ray 4.9 R 2-116 None


© NPIDB team 2003 - 2019

text