Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: Q6CX80
RecName: KLLA0A10483p
Begin-End: 73-141
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPIS
KTVRFNVLK
Structures of the domain Q6CX80 73-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 L 73-141 None
3jam X-ray 3.46 L 73-141 None
3jap X-ray 4.9 L 73-141 None
3j81 X-ray 4 L 73-141 None
3j80 X-ray 3.75 L 73-141 None


© NPIDB team 2003 - 2020

text