Pfam domain
Pfam family: Ribosomal_S17_N (PF16205.4)
Uniprot AC: Q6CX80
RecName: KLLA0A10483p
Begin-End: 8-71
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
QSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIR
GKIL
Structures of the domain Q6CX80 8-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 L 8-71 None
3j80 X-ray 3.75 L 8-71 None
3jam X-ray 3.46 L 8-71 None
3jaq X-ray 6 L 133-210 None
3j81 X-ray 4 L 133-71 None
3jap X-ray 4.9 L 133-210 None


© NPIDB team 2003 - 2019

text