Pfam domain
Pfam family: Ribosomal_S19e (PF01090.18)
Uniprot AC: Q6CXM0
RecName: KLLA0A07194p
Begin-End: 5-142
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
SVRDVPAQDFINNYASFLQRQGKLEVPGYVDIVKTSAGNELPPQDSEGWFYKRAASVARH
IYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINRKVLQSLEKLGVVEISPKGGRRI
SDNGLRDLDRIAAATLED
Structures of the domain Q6CXM0 5-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 T 5-140 None
3j80 X-ray 3.75 T 5-140 None
3jam X-ray 3.46 T 5-140 None
3jaq X-ray 6 T 5-140 None
3j81 X-ray 4 T 5-140 None
3jap X-ray 4.9 T 5-140 None


© NPIDB team 2003 - 2019

text