Pfam domain
Pfam family: Cohesin_HEAT (PF12765.9)
Uniprot AC: Q6KC79
RecName: Nipped-B-like protein
Begin-End: 1794-1835
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELL
Structures of the domain Q6KC79 1794-1835
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 E 1794-1835  H-Bb 
6wge X-ray 3.9 E 1794-1835  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text