Pfam domain
Pfam family: Nipped-B_C (PF12830.9)
Uniprot AC: Q6KC79
RecName: Nipped-B-like protein
Begin-End: 2275-2456
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAM
RNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQAINTCLKDPVRGFRQDESSSALCSH
LYSMIRGNRQHRRAFLISLLNLFDDTAKTDVTMLLYIADNLACFPYQTQEEPLFIMHHID
IT
Structures of the domain Q6KC79 2275-2456
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 E 2275-2456 None
6wge X-ray 3.9 E 2275-2456 None


© NPIDB team 2003 - 2021

text