Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: Q6L703
RecName: rRNA intron-encoded endonuclease
Begin-End: 12-112
Organism: Vulcanisaeta distributa
Interaction Mode:   

Sequence:
ILGFIEAEGSFSVSIKFQRDVFGGVRLDPVFSITQKNREVLEAIKEHLGIGRIIEKAGQP
NTYVYVVDNFNELVKLINFLNKYADFMIVKKRQFLIFREIA
Structures of the domain Q6L703 12-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e54 X-ray 2.5 B 212-311 None
3e54 X-ray 2.5 A 12-111 None


© NPIDB team 2003 - 2020

text