Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: Q6NKI3
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 667-810
Organism: Corynebacterium diphtheriae
Interaction Mode:   

Sequence:
SVAWMANELRSRVAQHFASHGTTVRVYRGSLTAEARRASGISGKLKFFDGVGKSRLDRRH
HAIDAAVIAFTSDYVAETLAVRSNLKQSQAHRQEAPQWREFTGKDAEHRAAWRVWCQKME
KLSALLTEDLRDDRVVVMSNVRLR
Structures of the domain Q6NKI3 667-810
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6joo X-ray 2.9 A 700-802 None


© NPIDB team 2003 - 2021

text