Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q6NXT2
RecName: Histone H3.3C
Begin-End: 39-131
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEA
YLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain Q6NXT2 39-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4z5t X-ray 2.8 E 38-130  H-Bb H-Mj S-Bb L-Bb L-Mn 
4z5t X-ray 2.8 A 37-130  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text