Pfam domain
Pfam family: PRP8_domainIV (PF12134.7)
Uniprot AC: Q6P2Q9
RecName: Pre-mRNA-processing-splicing factor 8
Begin-End: 1760-1989
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFL
KIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDF
PNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILI
LRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Structures of the domain Q6P2Q9 1760-1989
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 A 1760-1989 None
5o9z X-ray 4.5 A 1760-1989 None


© NPIDB team 2003 - 2019

text