Pfam domain
Pfam family: PROCT (PF08084.10)
Uniprot AC: Q6P2Q9
RecName: Pre-mRNA-processing-splicing factor 8
Begin-End: 2212-2319
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFF
MVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFAL
Structures of the domain Q6P2Q9 2212-2319
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 A 2212-2318 None


© NPIDB team 2003 - 2019

text