Pfam domain
Pfam family: PROCN (PF08083.10)
Uniprot AC: Q6P2Q9
RecName: Pre-mRNA-processing-splicing factor 8
Begin-End: 395-801
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYY
VLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLN
YLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQL
ADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGW
RVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDIL
DMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTA
HYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYI
Structures of the domain Q6P2Q9 395-801
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 A 396-801 None
5o9z X-ray 4.5 A 396-801 None


© NPIDB team 2003 - 2019

text