Pfam domain
Pfam family: PHD_4 (PF16866.4)
Uniprot AC: Q6PCT2
RecName: F-box/LRR-repeat protein 19
Begin-End: 82-149
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
LPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEIVHPGCLKMGKAEGVINAEIPN
CWECPRCT
Structures of the domain Q6PCT2 82-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6asb X-ray 2.85 C 82-149  L-Bb 
6asb X-ray 2.85 I 82-149 None
6asb X-ray 2.85 L 82-149 None


© NPIDB team 2003 - 2019

text