Pfam domain
Pfam family: FtsJ (PF01728.18)
Uniprot AC: Q6YMS4
RecName: Genome polyprotein
Begin-End: 2544-2714
Organism: Dengue virus type 3
Interaction Mode:   

Sequence:
AVSRGSAKLQWFVERNMVVPEGRVIDLGCGRGGWSYYCAGLKKVTEVRGYTKGGPGHEEP
VPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDIGESSPSPTVEESRTIRVLKMVEPWLK
NNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLSRNSTHEMYWISNGT
Structures of the domain Q6YMS4 2544-2714
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dto X-ray 2.6 A 55-222 None


© NPIDB team 2003 - 2019

text