Pfam domain
Pfam family: Tfb5 (PF06331.11)
Uniprot AC: Q6ZYL4
RecName: General transcription factor IIH subunit 5
Begin-End: 1-62
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MD
Structures of the domain Q6ZYL4 1-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 1 1-62 None
5iy8 X-ray 7.9 1 1-62 None
5ivw X-ray 10 1 1-62 None
5iy6 X-ray 7.2 1 1-62 None
5iy9 X-ray 6.3 1 1-62 None


© NPIDB team 2003 - 2019

text