Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q71DI3
RecName: Histone H3.2
Begin-End: 38-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAS
EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain Q71DI3 38-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5b40 X-ray 3.33 E 41-131  H-Bb H-Mj 
5b40 X-ray 3.33 A 41-131  H-Bb H-Mj 
3av1 X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av1 X-ray 2.5 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0z X-ray 1.99 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0z X-ray 1.99 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0y X-ray 2.56 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0y X-ray 2.56 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6fml X-ray 4.34 Q 38-131 None
6fml X-ray 4.34 M 40-131 None


© NPIDB team 2003 - 2019

text